PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012572839.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family bHLH
Protein Properties Length: 146aa    MW: 17328.9 Da    PI: 9.2275
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012572839.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH40.84.1e-1376127154
                     CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
             HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 
                     +++ h+ +Er+RR+++ +  + Lr+llP  +   ++K s ++ + +Av+YIk++
  XP_012572839.1  76 KKMVHKVIERQRRKEMATFCSSLRSLLPLEF--IKGKRSISDHVNEAVKYIKHM 127
                     6889*************************65..********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000838.50E-975131No hitNo description
PROSITE profilePS5088812.97675127IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.3E-1076127IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474596.54E-1376142IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.8E-1176142IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003530.001281133IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MMDHTMFPLH QGNVIHFSNS PHNQQHKIFE DLILDDYDSL LVNDCDKLFN FSSSQPNKIF  60
DEAIKNHDNC NQQMKKKMVH KVIERQRRKE MATFCSSLRS LLPLEFIKGK RSISDHVNEA  120
VKYIKHMKNN INELSAKRDE LKKFFH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012572839.11e-104PREDICTED: transcription factor bHLH126-like
TrEMBLA0A072TL374e-60A0A072TL37_MEDTR; Transcription factor
STRINGGLYMA16G32620.17e-54(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79233125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51780.14e-25bHLH family protein